-
BAM-15 Capsules $195.00 -
Tesamorelin/Ipamorelin Blend $105.00
in stock
In stock
Tesamorelin/Ipamorelin Blend
$105.00
In Stock99%+ PurityThird-Party TestedStrictly For In-Vitro UseUS Finished
Tesamorelin/Ipamorelin is a blend of two peptide research compounds for growth hormone pathway studies.
≥99% PurityMade in the USAResearch Grade
- ≥99% purity — third-party HPLC & MS tested
- Lyophilized & vacuum-sealed for maximum stability
- Cold-chain shipped • fast US & international delivery
Estimate delivery times: 3-5 days.
Delivered to your Door
To process your order please Make an Account
Guarantee Safe Checkout:
Description
Description
Tesamorelin/Ipamorelin Blend comes in the form of a Lyophilized powder. Each unit consists of one vial either containing approximately 13mg combined/vial (10mg Tesa/3mg Ipa) or 8mg combined/vial (6mg Tesa/2mg Ipa).
Tesamorelin Properties (PubChem)
- Molecular formula: C223H370N72O69
- Molecular weight: 5196 g/mol
- Synonym: Tesamorelin acetate
- Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
- CAS number: 901758-09-6
Ipamorelin Properties (PubChem)Ipamorelin comes in the form of a Lyophilized powder. Each unit consists of one vial containing either 5mg/vial or 10mg/vial.
- Molecular formula: C38H49N9O5
- Molecular weight: 711.9 g/mol
- Sequence: Aib-His-D-2-Nal-D-Phe-Lys
- CAS number: 170851-70-4
Tesamorelin/Ipamorelin is a blend of two peptide research compounds for growth hormone pathway studies.
Research Use Only
DISCLAIMER: All products listed on this site are for research purposes ONLY. This product is NOT intended for human or animal consumption of any kind and are subject to our terms of purchase.
Only qualified professionals with appropriate expertise should manage and handle this product. The distributor, manufacturer, and seller of this product disclaim any responsibility for its misuse or any resulting consequences. By accessing this product, you consent to comply with these terms and conditions.
Certificate of Analysis
Independent third-party lab testing — HPLC purity and bacterial endotoxin results are published for every batch.
Shipping & returns
Dispatched within 24 hours, via 2-Day Air, discreetly packaged.
Refunds and replacements are eligible for broken or incorrect items — email hello@minutemanpeptides.com within 48 hours of delivery with your order number.
Reconstitution & storage
Storage — keep cool and dry, away from direct sunlight. Refrigerate at 2–8 °C after reconstitution.
Supplied as lyophilized powder for laboratory research. Not for human or animal use.
Premium Research Peptides
For Research Purposes Only
Related products
Compound information
Molecular profile
What is Tesamorelin?
- Type
- Synthetic peptide
- Class
- GHRH(1–44) analog
- Amino acids
- 44
- Molecular weight
- ~5,136 g/mol
- Form
- Lyophilized powder
Storage requirements
Stability information
Avoid freeze/thaw cycles
Protect from light
Refrigerate once reconstituted
Lyophilized (powder)
−20 °C · 24+ months
Reconstituted
2–8 °C · ~14–28 days
Research applications
- GHRH receptor research
- Adipose tissue metabolism studies
- Endocrine research models
Sources & references
AIDS (London, England)
Efficacy and safety of tesamorelin in people with HIV on integrase inhibitors
2024 · PMID 38905488
Russo SC, et al. View on PubMed ↗
Nature reviews. Drug discovery
Tesamorelin
2011 · PMID 21283099
Grunfeld C, et al. View on PubMed ↗
The Annals of pharmacotherapy
Tesamorelin: a growth hormone-releasing factor analogue for HIV-associated lipodystrophy
2012 · PMID 22298602
Spooner LM, et al. View on PubMed ↗
For Research Use Only. Not for use in diagnostic procedures or human or veterinary applications. This product is sold exclusively as a laboratory reagent for qualified scientific investigation and is not intended to diagnose, treat, cure, or prevent any disease. Specifications are provided for reference only — see the certificate library for batch data.