Tesamorelin/Ipamorelin Blend comes in the form of a Lyophilized powder. Each unit consists of one vial containing approximately 13mg combined/vial (10mg Tesa/3mg Ipa).
Tesamorelin Properties (PubChem)
- Molecular formula: C223H370N72O69S
Molecular weight: 5196 g/mol
Synonym: Tesamorelin acetate
Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
CAS number: 901758-09-6
Ipamorelin Properties (PubChem)Ipamorelin comes in the form of a Lyophilized powder. Each unit consists of one vial containing either 5mg/vial or 10mg/vial.
- Molecular formula: C38H49N9O5
- Molecular weight: 711.9 g/mol
- Sequence: Aib-His-D-2-Nal-D-Phe-Lys
- CAS number: 170851-70-4
Tesamorelin/Ipamorelin is a blend of two peptide research compounds for growth hormone pathway studies.Â
Research Use Only
DISCLAIMER: All products listed on this site are for research purposes ONLY. This product is NOT intended for human or animal consumption of any kind and are subject to our terms of purchase.
Only qualified professionals with appropriate expertise should manage and handle this product. The distributor, manufacturer, and seller of this product disclaim any responsibility for its misuse or any resulting consequences. By accessing this product, you consent to comply with these terms and conditions.
Reviews
There are no reviews yet.