-
Melanotan II (10mg) $50.00 -
FOX04-DRI (10mg) $150.00 -
Melanotan I (10mg) $50.00 -
Cerebro Protein (60mg) $120.00 -
IGF1-LR3 (.1mg) $60.00 -
Noopept Capsules (20mg) $95.00
Only left in stock
In stock
Cagrilintide
$85.00 – $130.00
In Stock98%+ PurityThird-Party TestedStrictly For In-Vitro UseUS Finished
Cagrilintide
≥99% PurityMade in the USAResearch Grade
- ≥99% purity — third-party HPLC & MS tested
- Lyophilized & vacuum-sealed for maximum stability
- Cold-chain shipped • fast US & international delivery
Orders before 2pm EST ship same day via UPS.
Delivered to your Door
Create an account to track orders and reorder faster.
Guarantee Safe Checkout:
Description
Description
Cagrilintide Properties (PubChem)
Cagrilintide comes in the form of a Lyophilized powder. Units consist of one vial containing 10mg/vial.
- Molecular formula: C194H312N54O59S2
- Molecular weight: 4409 g/mol
- Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
- CAS number: 1415456-99-3
Cagrilintide It is lyophilized for stability and precise laboratory handling. This product is intended for research purposes only and is not suitable for human or animal consumption. 3rd-party testing is conducted with detailed Certificates of Analysis (CoA) available to support consistent reproducible experimentation and to confirm molecular weight, identity and purity.
Research Use Only
DISCLAIMER: All products listed on this site are for research purposes ONLY. This product is NOT intended for human or animal consumption of any kind and are subject to our terms of purchase.
Only qualified professionals with appropriate expertise should manage and handle this product. The distributor, manufacturer, and seller of this product disclaim any responsibility for its misuse or any resulting consequences. By accessing this product, you consent to comply with these terms and conditions.
Additional information
Additional information
| Volume | 5mg, 10mg |
|---|
Certificate of Analysis
Independent third-party lab testing — HPLC purity and bacterial endotoxin results are published for every batch.
Shipping & returns
Dispatched within 24 hours, via 2-Day Air, discreetly packaged.
Refunds and replacements are eligible for broken or incorrect items — email hello@minutemanpeptides.com within 48 hours of delivery with your order number.
Reconstitution & storage
Storage — keep cool and dry, away from direct sunlight. Refrigerate at 2–8 °C after reconstitution.
Supplied as lyophilized powder for laboratory research. Not for human or animal use.
Premium Research Peptides
For Research Purposes Only
