0
0
Subtotal: $0.00

No products in the cart.

No products in the cart.

Tesamorelin (10mg)

$90.00

+ Free Shipping

Tesamorelin is a peptide research compound for growth hormone pathway studies.

- +
Bulk deal
Quantity Discount Discounted price
3 - 4 3% $87.30
5 - 7 5% $85.50
8 - 10 7% $83.70
11 - 20 10% $81.00
Guaranteed Safe Checkout

COAs


Tesamorelin Properties (PubChem)

Tesamorelin comes in the form of a Lyophilized powder.  Each unit consists of one vial containing 10mg/vial.

  • Molecular formula: C223H370N72O69S
    Molecular weight: 5196 g/mol
    Synonym: Tesamorelin acetate
    Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
    CAS number: 901758-09-6

Tesamorelin is a peptide research compound for growth hormone pathway studies. 

Research Use Only

 

DISCLAIMER: All products listed on this site are for research purposes ONLY. This product is NOT intended for human or animal consumption of any kind and are subject to our terms of purchase.

Only qualified professionals with appropriate expertise should manage and handle this product. The distributor, manufacturer, and seller of this product disclaim any responsibility for its misuse or any resulting consequences. By accessing this product, you consent to comply with these terms and conditions.

 

COA NamePDFDate Archived
10mg

10mg

Reviews

There are no reviews yet.

Be the first to review “Tesamorelin (10mg)”

Your email address will not be published. Required fields are marked *

Tesamorelin (10mg)Tesamorelin (10mg)
Secret Link